| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFB2M |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFB2M Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFB2M. This antibody reacts with human. The TFB2M Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED |
|---|
| Other Names | dimethyladenosine transferase 2, mitochondrial, EC 2.1.1.-, FLJ22661, FLJ23182, HCV NS5A-transactivated protein 5, Hepatitis C virus NS5A-transactivated protein 5, Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, mtTFB2, NS5ATP5, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2, transcription factor B2, mitochondrial |
|---|
| Gene, Accession # | TFB2M, Gene ID: 64216 |
|---|
| Catalog # | NBP2-68602 |
|---|
| Price | |
|---|
| Order / More Info | TFB2M Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|