| 产品详情 |
| Edit |   |
| Antigenic Specificity | MIG2/Kindlin-2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MIG2/Kindlin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIG2/Kindlin-2. This antibody reacts with human. The MIG2/Kindlin-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MIG2/Kindlin-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA |
| Other Names | fermitin family homolog 2, fermitin family homolog 2 (Drosophila), fermitin family member 2, KIND2DKFZp686G11125, kindlin 2, Kindlin-2, mig-2, MIG2FLJ34213, mitogen inducible gene 2 protein, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, pleckstrin homology domain containing, family C (with FERM domain) member 1, pleckstrin homology domain containing, family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1FLJ44462, UNC112, UNC112B |
| Gene, Accession # | FERMT2, Gene ID: 10979, Accession: Q96AC1, SwissProt: Q96AC1 |
| Catalog # | NBP1-87884 |
| Price | |
| Order / More Info | MIG2/Kindlin-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|