| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RIPK3/RIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RIPK3/RIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIPK3/RIP3. This antibody reacts with human. The RIPK3/RIP3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RIPK3/RIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG |
|---|
| Other Names | EC 2.7.11.1, Receptor-interacting protein 3, receptor-interacting serine/threonine-protein kinase 3, receptor-interacting serine-threonine kinase 3, RIP-3, RIP3receptor interacting protein 3, RIP-like protein kinase 3 |
|---|
| Gene, Accession # | RIPK3, Gene ID: 11035 |
|---|
| Catalog # | NBP2-49167 |
|---|
| Price | |
|---|
| Order / More Info | RIPK3/RIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|