| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EphB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EphB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EphB2. This antibody reacts with human. The EphB2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human EphB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI |
|---|
| Other Names | CAPB, DRTEphB2, EC 2.7.10, EC 2.7.10.1, EK5, elk-related tyrosine kinase, EPH receptor B2, eph tyrosine kinase 3, EPH-like kinase 5, ephrin type-B receptor 2, EPHT3MGC87492, EPTH3, ERKHek5, HEK5, PCBC, protein-tyrosine kinase HEK5, Renal carcinoma antigen NY-REN-47, Tyro5, Tyrosine-protein kinase receptor EPH-3, Tyrosine-protein kinase TYRO5 |
|---|
| Gene, Accession # | EPHB2, Gene ID: 2048 |
|---|
| Catalog # | NBP2-56605 |
|---|
| Price | |
|---|
| Order / More Info | EphB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|