| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | E6AP/UBE3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The E6AP/UBE3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to E6AP/UBE3A. This antibody reacts with human. The E6AP/UBE3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human E6AP/UBE3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVK |
|---|
| Other Names | ANCREPVE6AP, AS, CTCL tumor antigen se37-2, E6AP, E6-AP, E6AP ubiquitin-protein ligase, EC 6.3.2.-, FLJ26981, HPVE6A, human papilloma virus E6-associated protein, Human papillomavirus E6-associated protein, Oncogenic protein-associated protein E6-AP, Renal carcinoma antigen NY-REN-54, ubiquitin protein ligase E3A, ubiquitin-protein ligase E3A |
|---|
| Gene, Accession # | UBE3A, Gene ID: 7337, Accession: Q05086, SwissProt: Q05086 |
|---|
| Catalog # | NBP2-38463 |
|---|
| Price | |
|---|
| Order / More Info | E6AP/UBE3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|