| Edit |   |
|---|
| Antigenic Specificity | EAF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EAF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EAF1. This antibody reacts with human. The EAF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EAF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRN |
|---|
| Other Names | ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1, ELL associated factor 1, ELL-associated factor 1 |
|---|
| Gene, Accession # | EAF1, Gene ID: 85403 |
|---|
| Catalog # | NBP2-49604 |
|---|
| Price | |
|---|
| Order / More Info | EAF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|