| Edit |   |
| Antigenic Specificity | EAAT2/GLT1 |
| Clone | 1D8 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EAAT2/GLT1 Antibody (1D8) from Novus Biologicals is a mouse monoclonal antibody to EAAT2/GLT1. This antibody reacts with human. The EAAT2/GLT1 Antibody (1D8) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | SLC1A2 (NP_004162 160 a.a. - 239 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG |
| Other Names | GLT1, member 2, solute carrier family 1 (glial high affinity glutamate transporter), member 2, Solute carrier family 1 member 2 |
| Gene, Accession # | SLC1A2, Gene ID: 6506, Accession: NP_004162, SwissProt: NP_004162 |
| Catalog # | H00006506-M07 |
| Price | |
| Order / More Info | EAAT2/GLT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |