| Edit |   |
| Antigenic Specificity | DYSFIP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DYSFIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DYSFIP1. This antibody reacts with human. The DYSFIP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DYSFIP1(dysferlin interacting protein 1) The peptide sequence was selected from the middle region of DYSFIP1. Peptide sequence DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK. |
| Other Names | dysferlin interacting protein 1, dysferlin interacting protein 1 (toonin), dysferlin-interacting protein 1, dysferlin-interacting protein 1 (toonin), MGC138299, toonin |
| Gene, Accession # | PPP1R27, Gene ID: 116729, Accession: Q86WC6, SwissProt: Q86WC6 |
| Catalog # | NBP1-55525-20ul |
| Price | |
| Order / More Info | DYSFIP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |