| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAD4. This antibody reacts with human. The MAD4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MAD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNEL |
|---|
| Other Names | BHLHC12, bHLHc12Max-interacting transcriptional repressor MAD4, Class C basic helix-loop-helix protein 12, Mad4 homolog, MAD4Max-associated protein 4, MAX dimerization protein 4, Max dimerizer 4, MST149, MSTP149, MXD4 MAX dimerization protein 4 |
|---|
| Gene, Accession # | MXD4, Gene ID: 10608 |
|---|
| Catalog # | NBP2-58767 |
|---|
| Price | |
|---|
| Order / More Info | MAD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|