| 产品详情 |
| Edit |   |
| Antigenic Specificity | MICAL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MICAL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MICAL1. This antibody reacts with human. The MICAL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MICAL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSSLNLTPDPEMEPPPKPPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPT |
| Other Names | CasL interacting molecule, DKFZp434B1517, FLJ11937, FLJ21739, MICALMolecule interacting with CasL protein 1, microtubule associated monoxygenase, calponin and LIM domain containing 1, NEDD9 interacting protein with calponin homology and LIM domains, NEDD9-interacting protein with calponin homology and LIM domains, NICALMICAL-1 |
| Gene, Accession # | MICAL1, Gene ID: 64780, Accession: Q8TDZ2, SwissProt: Q8TDZ2 |
| Catalog # | NBP2-38154 |
| Price | |
| Order / More Info | MICAL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|