| Edit |   |
|---|
| Antigenic Specificity | MICA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MICA Antibody from Novus Biologicals is a rabbit polyclonal antibody to MICA. This antibody reacts with human. The MICA Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MICA(MHC class I polypeptide-related sequence A) The peptide sequence was selected from the N terminal of MICA. Peptide sequence LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ. |
|---|
| Other Names | FLJ60820, MGC111087, PERB11.1 |
|---|
| Gene, Accession # | MICA, Gene ID: 100507436, Accession: Q29983, SwissProt: Q29983 |
|---|
| Catalog # | NBP1-59184 |
|---|
| Price | |
|---|
| Order / More Info | MICA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|