| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDB1. This antibody reacts with human. The DDB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DDB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA |
|---|
| Other Names | damage-specific DNA binding protein 1 (127kD), damage-specific DNA binding protein 1, 127kDa, Damage-specific DNA-binding protein 1, DDB p127 subunit, DDBa, DNA damage-binding protein 1, DNA damage-binding protein a, HBV X-associated protein 1, UV-damaged DNA-binding factor, UV-damaged DNA-binding protein 1, UV-DDB 1, UV-DDB1, XAP1, XAP-1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE, XPE-BF, XPE-binding factor |
|---|
| Gene, Accession # | DDB1, Gene ID: 1642 |
|---|
| Catalog # | NBP2-57877 |
|---|
| Price | |
|---|
| Order / More Info | DDB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|