| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDAH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDAH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDAH2. This antibody reacts with human. The DDAH2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to DDAH2 (dimethylarginine dimethylaminohydrolase 2). The peptide sequence was selected from the N-terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG. |
|---|
| Other Names | DDAHII, dimethylargininase-2, dimethylarginine dimethylaminohydrolase 2G6a, dimethylarginine dimethylaminohydrolase II, EC 3.5.3.18, G6a, N(G), N(G)-dimethylarginine dimethylaminohydrolase 2, NG30, NG-dimethylarginine dimethylamino hydrolase homolog, S-phase protein |
|---|
| Gene, Accession # | DDAH2, Gene ID: 23564, Accession: O95865, SwissProt: O95865 |
|---|
| Catalog # | NBP1-58859 |
|---|
| Price | |
|---|
| Order / More Info | DDAH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|