| 产品详情 |
| Edit |   |
| Antigenic Specificity | DDA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DDA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDA1. This antibody reacts with human. The DDA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DDA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELE |
| Other Names | C19orf58, cross-immune reaction antigen PCIA1, DET1 and DDB1 associated 1, DET1- and DDB1-associated protein 1, MGC2594, PCIA-1, PCIA1chromosome 19 open reading frame 58, Placenta cross-immune reaction antigen 1 |
| Gene, Accession # | DDA1, Gene ID: 79016 |
| Catalog # | NBP1-89891 |
| Price | |
| Order / More Info | DDA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|