| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTSL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTSL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTSL5. This antibody reacts with human. The ADAMTSL5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Specificity of human ADAMTSL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ |
|---|
| Other Names | ADAMTSL-5, ADAMTS-like 5, ADAMTS-like protein 5, thrombospondin type-1 domain-containing protein 6, thrombospondin, type I, domain containing 6, THSD6 |
|---|
| Gene, Accession # | ADAMTSL5, Gene ID: 339366, Accession: Q6ZMM2, SwissProt: Q6ZMM2 |
|---|
| Catalog # | NBP1-93438 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTSL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27857980 |
|---|
| 产品资料 |
|
|