| 产品详情 |
| Edit |   |
| Antigenic Specificity | ARF4L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARF4L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARF4L. This antibody reacts with human. The ARF4L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARF4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT |
| Other Names | ADP-ribosylation factor 4-like, ADP-ribosylation factor-like 4D, ADP-ribosylation factor-like protein 4D, ADP-ribosylation factor-like protein 4L, ARF4LADP-ribosylation factor-like 6, ARL6 |
| Gene, Accession # | ARL4D, Gene ID: 379, Accession: P49703, SwissProt: P49703 |
| Catalog # | NBP2-31820 |
| Price | |
| Order / More Info | ARF4L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|