| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WDR62 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR62 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR62. This antibody reacts with human. The WDR62 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human WDR62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YVSTPSEIHSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRLLGDDDVADGSAFHAKRSYQPHGRWAERAGQEPLKTILD |
|---|
| Other Names | C19orf14MGC166976, chromosome 19 open reading frame 14, DKFZP434J046, DKFZp686G1024, EC 2.7.11.1, EC 2.7.7.38, FLJ33298, WD repeat domain 62, WD repeat-containing protein 62 |
|---|
| Gene, Accession # | WDR62, Gene ID: 284403 |
|---|
| Catalog # | NBP2-48788 |
|---|
| Price | |
|---|
| Order / More Info | WDR62 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|