| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UEVLD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UEVLD Antibody from Novus Biologicals is a rabbit polyclonal antibody to UEVLD. This antibody reacts with human. The UEVLD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UEVLD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA |
|---|
| Other Names | Attp, EV and lactate/malate dehydrogenase domain-containing protein, signaling molecule ATTP, ubiquitin-conjugating enzyme E2 variant 3, UEV and lactate/malate dehyrogenase domains, UEV-3, UEV3FLJ11068 |
|---|
| Gene, Accession # | UEVLD, Gene ID: 55293 |
|---|
| Catalog # | NBP1-92561 |
|---|
| Price | |
|---|
| Order / More Info | UEVLD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|