| 产品详情 |
| Edit |   |
| Antigenic Specificity | PIK3R5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PIK3R5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIK3R5. This antibody reacts with human. The PIK3R5 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PIK3R5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP |
| Other Names | F730038I15Rik, FOAP-2, p101, P101-PI3K, Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit, phosphoinositide-3-kinase, regulatory subunit 5, phosphoinositide-3-kinase, regulatory subunit, polypeptide p101, PI3-kinase p101 subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, regulatory subunit 5, p101 |
| Gene, Accession # | PIK3R5, Gene ID: 23533 |
| Catalog # | NBP2-57055 |
| Price | |
| Order / More Info | PIK3R5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|