Edit |   |
Antigenic Specificity | Sec1 Family Domain Containing 1 (SCFD1) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME |
Other Names | DDBDRAFT_0188070|DDBDRAFT_0234142|DDB_0188070|DDB_0234142|C14orf163|RA410|SLY1|SLY1P|STXBP1L2|3110021P21Rik|Sly1|rSly1 |
Gene, Accession # | Gene ID: 23256,76983,54350 |
Catalog # | ABIN632406 |
Price | |
Order / More Info | Sec1 Family Domain Containing 1 (SCFD1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |