| 产品详情 |
| Edit |   |
| Antigenic Specificity | HNRPDL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HNRPDL Antibody from Novus Biologicals is a rabbit polyclonal antibody to HNRPDL. This antibody reacts with human. The HNRPDL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HNRPDL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM |
| Other Names | A+U-rich element RNA binding factor, AU-rich element RNA-binding factor, heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP DL, hnRNP D-like, JKTBP2, JKTBPJKT41-binding protein, laAUF1, Protein laAUF1 |
| Gene, Accession # | HNRPDL, Gene ID: 9987, Accession: O14979, SwissProt: O14979 |
| Catalog # | NBP2-38806 |
| Price | |
| Order / More Info | HNRPDL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|