| Edit |   |
|---|
| Antigenic Specificity | HNRPA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HNRPA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HNRPA3. This antibody reacts with human. The HNRPA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human HNRPA3. Peptide sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS. |
|---|
| Other Names | heterogeneous nuclear ribonucleoprotein A3 |
|---|
| Gene, Accession # | HNRNPA3, Gene ID: 220988, Accession: NP_919223, SwissProt: NP_919223 |
|---|
| Catalog # | NBP1-80486 |
|---|
| Price | |
|---|
| Order / More Info | HNRPA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|