| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HNRNPUL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HNRNPUL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HNRNPUL1. This antibody reacts with human. The HNRNPUL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HNRNPUL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE |
|---|
| Other Names | Adenovirus early region 1B-associated protein 5, E1B-AP5E1B 55kDa associated protein 5, E1BAP5E1B-55 kDa-associated protein 5, FLJ12944, heterogeneous nuclear ribonucleoprotein U-like 1, heterogeneous nuclear ribonucleoprotein U-like protein 1, HNRPUL1E1B-55kDa-associated protein 5 |
|---|
| Gene, Accession # | HNRNPUL1, Gene ID: 11100 |
|---|
| Catalog # | NBP2-47432 |
|---|
| Price | |
|---|
| Order / More Info | HNRNPUL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|