| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | hnRNP U |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The hnRNP U Antibody from Novus Biologicals is a rabbit polyclonal antibody to hnRNP U. This antibody reacts with human, mouse. The hnRNP U Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human hnRNP U antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGG |
|---|
| Other Names | heterogeneous nuclear ribonucleoprotein U, heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A), hnRNP U, HNRPU, p120, p120 nuclear protein, pp120, SAFA, SAF-AhnRNPU, Scaffold attachment factor A, U21.1 |
|---|
| Gene, Accession # | HNRNPU, Gene ID: 3192 |
|---|
| Catalog # | NBP2-49290 |
|---|
| Price | |
|---|
| Order / More Info | hnRNP U Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30044993 |
|---|
| 产品资料 |
|
|