| Edit |   |
|---|
| Antigenic Specificity | hnRNP-R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The hnRNP-R Antibody from Novus Biologicals is a rabbit polyclonal antibody to hnRNP-R. This antibody reacts with human. The hnRNP-R Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HNRNPR(heterogeneous nuclear ribonucleoprotein R) The peptide sequence was selected from the N terminal of HNRNPR. Peptide sequence ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ. |
|---|
| Other Names | FLJ25714, heterogeneous nuclear ribonucleoprotein R, hnRNP R, HNRPRhnRNP-R |
|---|
| Gene, Accession # | HNRNPR, Gene ID: 10236, Accession: O43390, SwissProt: O43390 |
|---|
| Catalog # | NBP1-57158 |
|---|
| Price | |
|---|
| Order / More Info | hnRNP-R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|