| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | hnRNP-R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The hnRNP-R Antibody from Novus Biologicals is a rabbit polyclonal antibody to hnRNP-R. This antibody reacts with human, mouse. The hnRNP-R Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse hnRNP-R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT |
|---|
| Other Names | FLJ25714, heterogeneous nuclear ribonucleoprotein R, hnRNP R, HNRPRhnRNP-R |
|---|
| Gene, Accession # | HNRNPR, Gene ID: 10236 |
|---|
| Catalog # | NBP1-89676 |
|---|
| Price | |
|---|
| Order / More Info | hnRNP-R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25338097 |
|---|
| 产品资料 |
|
|