| Edit |   |
| Antigenic Specificity | C16orf95 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C16orf95 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C16orf95. This antibody reacts with human. The C16orf95 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C16orf95 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS |
| Other Names | AC010531.1, chromosome 16 open reading frame 95, DKFZp434J1815, FLJ22477, hypothetical protein LOC100506581 |
| Gene, Accession # | C16ORF95, Gene ID: 100506581 |
| Catalog # | NBP1-91131 |
| Price | |
| Order / More Info | C16orf95 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |