| 产品详情 |
| Edit |   |
| Antigenic Specificity | UGT1A6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UGT1A6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UGT1A6. This antibody reacts with human. The UGT1A6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UGT1A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY |
| Other Names | GNT1UDPGT 1-6, HLUGP, HLUGP1, MGC29860, Phenol-metabolizing UDP-glucuronosyltransferase, UDP glucuronosyltransferase 1 family, polypeptide A6, UDP glycosyltransferase 1 family, polypeptide A6, UDP-glucuronosyltransferase 1 family polypeptide A6s, UDP-glucuronosyltransferase 1-6, UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-F, UDPGT, UGT1, UGT1*6, UGT1.6, UGT1-06, UGT1A6S, UGT-1F, UGT1FEC 2.4.1.17 |
| Gene, Accession # | UGT1A6, Gene ID: 54578 |
| Catalog # | NBP2-49113 |
| Price | |
| Order / More Info | UGT1A6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|