| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UGP2 |
|---|
| Clone | 3H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UGP2 Antibody (3H3) from Novus Biologicals is a mouse monoclonal antibody to UGP2. This antibody reacts with human, mouse, rat. The UGP2 Antibody (3H3) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | UGP2 (NP_001001521, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI |
|---|
| Other Names | EC 2.7.7.9, pHC379, UDPG, UDP-glucose diphosphorylase, UDP-glucose pyrophosphorylase, UDP-glucose pyrophosphorylase 2, UDPGP, UDPGP2, UGP1, UGPase, UGPase 2, UGPP2, uridyl diphosphate glucose pyrophosphorylase 2, UTP-glucose-1-phosphate uridyltransferase, UTP--glucose-1-phosphate uridylyltransferase, UTP--glucose-1-phosphate uridylyltransferase 2 |
|---|
| Gene, Accession # | UGP2, Gene ID: 7360, Accession: NP_001001521, SwissProt: NP_001001521 |
|---|
| Catalog # | H00007360-M01 |
|---|
| Price | |
|---|
| Order / More Info | UGP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|