Edit |   |
Antigenic Specificity | Exportin 1, CRM1 Homolog (Yeast) (XPO1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is also involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. |
Immunogen | XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP |
Other Names | CG13387|CRM1|Crm1|DCRM1|Dmel\\CG13387|Emb|XPO-1|XPO1|Xpo1|crm1|dCRM1|l(2)k16715|18.m06600|DDBDRAFT_0183812|DDBDRAFT_0234066|DDB_0183812|DDB_0234066|exportin-1|LOC100220104|emb|exp1|Xpo|AA420417|Exp1 |
Gene, Accession # | Gene ID: 7514 |
Catalog # | ABIN633201 |
Price | |
Order / More Info | Exportin 1, CRM1 Homolog (Yeast) (XPO1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |