| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FCER1G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FCER1G Antibody from Novus Biologicals is a rabbit polyclonal antibody to FCER1G. This antibody reacts with human. The FCER1G Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FCER1G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
|---|
| Other Names | Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Fc-epsilon RI-gamma, FceRI gamma, FCRG, high affinity immunoglobulin epsilon receptor subunit gamma, IgE Fc receptor subunit gamma, immunoglobulin E receptor, high affinity, gamma chain |
|---|
| Gene, Accession # | FCER1G, Gene ID: 2207 |
|---|
| Catalog # | NBP1-85959 |
|---|
| Price | |
|---|
| Order / More Info | FCER1G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|