| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fc epsilon RI beta/MS4A2 |
|---|
| Clone | 3B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fc epsilon RI beta/MS4A2 Antibody (3B1) from Novus Biologicals is a mouse monoclonal antibody to Fc epsilon RI beta/MS4A2. This antibody reacts with human. The Fc epsilon RI beta/MS4A2 Antibody (3B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MS4A2 (NP_000130, 1 a.a. - 59 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE |
|---|
| Other Names | APY, ATOPY, Fc epsilon receptor I beta-chain, FCER1BIGEL, FCERI, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain), high affinity immunoglobulin epsilon receptor subunit beta, IgE Fc receptor subunit beta, IgE responsiveness (atopic), IGER, IGHER, immunoglobulin E receptor, high affinity, beta polypeptide, Membrane-spanning 4-domains subfamily A member 2, membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide), MS4A1 |
|---|
| Gene, Accession # | MS4A2, Gene ID: 2206, Accession: NP_000130, SwissProt: NP_000130 |
|---|
| Catalog # | H00002206-M02 |
|---|
| Price | |
|---|
| Order / More Info | Fc epsilon RI beta/MS4A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|