| Edit |   |
|---|
| Antigenic Specificity | MINOS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MINOS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MINOS1. This antibody reacts with human. The MINOS1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C1orf151. Peptide sequence IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ. |
|---|
| Other Names | mitochondrial inner membrane organizing system 1 |
|---|
| Gene, Accession # | MINOS1, Gene ID: 440574, Accession: NP_001027535, SwissProt: NP_001027535 |
|---|
| Catalog # | NBP1-91587 |
|---|
| Price | |
|---|
| Order / More Info | MINOS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26887443 |
|---|