| 产品详情 |
| Edit |   |
| Antigenic Specificity | Mineralocorticoid R/NR3C2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Mineralocorticoid R/NR3C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Mineralocorticoid R/NR3C2. This antibody reacts with human. The Mineralocorticoid R/NR3C2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Mineralocorticoid R/NR3C2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTL |
| Other Names | FLJ41052, MGC133092, mineralocorticoid receptor 1, mineralocorticoid receptor delta, MLRmineralocorticoid receptor, MRMCRaldosterone receptor, NR3C2VIT, Nuclear receptor subfamily 3 group C member 2, nuclear receptor subfamily 3, group C, member 2 |
| Gene, Accession # | NR3C2, Gene ID: 4306 |
| Catalog # | NBP2-57853 |
| Price | |
| Order / More Info | Mineralocorticoid R/NR3C2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|