| 产品详情 |
| Edit |   |
| Antigenic Specificity | CHTOP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CHTOP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHTOP. This antibody reacts with human. The CHTOP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CHTOP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND |
| Other Names | C1orf77, chromatin target of PRMT1, DKFZp547E1010, FOPMGC86949, Friend of PRMT1 protein, MGC131924, pp7704, RP1-178F15.2, Small arginine- and glycine-rich protein, small protein rich in arginine and glycine, SRAGchromosome 1 open reading frame 77 |
| Gene, Accession # | CHTOP, Gene ID: 26097 |
| Catalog # | NBP1-88085 |
| Price | |
| Order / More Info | CHTOP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|