| 产品详情 |
| Edit |   |
| Antigenic Specificity | c-Abl |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The c-Abl Antibody from Novus Biologicals is a rabbit polyclonal antibody to c-Abl. This antibody reacts with human. The c-Abl Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human c-Abl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP |
| Other Names | Abelson murine leukemia viral oncogene homolog 1, ABL, c-ABL, c-abl oncogene 1, non-receptor tyrosine kinase, c-abl oncogene 1, receptor tyrosine kinase, EC 2.7.10, EC 2.7.10.2, JTK7bcr/abl, p150bcr/c-abl oncogene protein, Proto-oncogene c-Abl, proto-oncogene tyrosine-protein kinase ABL1, tyrosine-protein kinase ABL1, v-abl, v-abl Abelson murine leukemia viral oncogene homolog 1 |
| Gene, Accession # | ABL1, Gene ID: 25 |
| Catalog # | NBP1-90287 |
| Price | |
| Order / More Info | c-Abl Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|