| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHST11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHST11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHST11. This antibody reacts with human. The CHST11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CHST11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLK |
|---|
| Other Names | C4S-1, C4ST, C4St-1, C4ST1EC 2.8.2.5, carbohydrate (chondroitin 4) sulfotransferase 11, carbohydrate sulfotransferase 11, Chondroitin 4-O-sulfotransferase 1, Chondroitin 4-sulfotransferase 1, DKFZp667A035, FLJ41682, HSA269537, IgH/CHST11 fusion |
|---|
| Gene, Accession # | CHST11, Gene ID: 50515, Accession: Q9NPF2, SwissProt: Q9NPF2 |
|---|
| Catalog # | NBP2-30481 |
|---|
| Price | |
|---|
| Order / More Info | CHST11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|