| Edit |   |
| Antigenic Specificity | PCDHGA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCDHGA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCDHGA4. This antibody reacts with human. The PCDHGA4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PCDHGA4(protocadherin gamma subfamily A, 4) The peptide sequence was selected from the N terminal of PCDHGA4. Peptide sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT. |
| Other Names | PCDH-GAMMA-A4, protocadherin gamma subfamily A, 4, protocadherin gamma-A4 |
| Gene, Accession # | PCDHGA4, Gene ID: 56111, Accession: Q9Y5G9-2, SwissProt: Q9Y5G9-2 |
| Catalog # | NBP1-59234 |
| Price | |
| Order / More Info | PCDHGA4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |