| Edit |   |
|---|
| Antigenic Specificity | PCDHGA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCDHGA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCDHGA4. This antibody reacts with human. The PCDHGA4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCDHGA4(protocadherin gamma subfamily A, 4) The peptide sequence was selected from the N terminal of PCDHGA4. Peptide sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT. |
|---|
| Other Names | PCDH-GAMMA-A4, protocadherin gamma subfamily A, 4, protocadherin gamma-A4 |
|---|
| Gene, Accession # | PCDHGA4, Gene ID: 56111, Accession: Q9Y5G9-2, SwissProt: Q9Y5G9-2 |
|---|
| Catalog # | NBP1-59234-20ul |
|---|
| Price | |
|---|
| Order / More Info | PCDHGA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|