| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glycophorin C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glycophorin C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glycophorin C. This antibody reacts with human. The Glycophorin C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Glycophorin C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
|---|
| Other Names | CD236, CD236 antigen, CD236R, GE, GLPC, glycoconnectin, glycophorin C (Gerbich blood group), glycophorin-C, glycophorin-D, Glycoprotein beta, GPCMGC126191, GPD, GYPD, MGC117309, MGC126192, PAS-2, PAS-2', Sialoglycoprotein D |
|---|
| Gene, Accession # | GYPC, Gene ID: 2995 |
|---|
| Catalog # | NBP1-84597 |
|---|
| Price | |
|---|
| Order / More Info | Glycophorin C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|