| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKG2A/CD159a/KLRC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKG2A/CD159a/KLRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKG2A/CD159a/KLRC1. This antibody reacts with human. The NKG2A/CD159a/KLRC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH. |
|---|
| Other Names | CD159 antigen-like family member A, CD159A, CD159a antigen, C-lectin type II protein, killer cell lectin-like receptor subfamily C, member 1, MGC13374, natural killer cell lectin, natural killer group protein 2, NK cell receptor A, NKG2, NKG2-1/B activating NK receptor, NKG2-A, NKG2-A/B type II integral membrane protein, NKG2-A/B-activating NK receptor, NKG2-A/NKG2-B type II integral membrane protein, NKG2AMGC59791, NKG2-B |
|---|
| Gene, Accession # | KLRC1, Gene ID: 3821, Accession: P26715-2, SwissProt: P26715-2 |
|---|
| Catalog # | NBP1-74093-20ul |
|---|
| Price | |
|---|
| Order / More Info | NKG2A/CD159a/KLRC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|