| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKG2A/CD159a/KLRC1 |
|---|
| Clone | 2C3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | ascites, no preservative |
|---|
| Size | 100 ug |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKG2A/CD159a/KLRC1 Antibody (2C3) from Novus Biologicals is a mouse monoclonal antibody to NKG2A/CD159a/KLRC1. This antibody reacts with human. The NKG2A/CD159a/KLRC1 Antibody (2C3) has been validated for the following applications: ELISA. |
|---|
| Immunogen | KLRC1 (NP_998823, 1 a.a. - 70 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK |
|---|
| Other Names | CD159 antigen-like family member A, CD159A, CD159a antigen, C-lectin type II protein, killer cell lectin-like receptor subfamily C, member 1, MGC13374, natural killer cell lectin, natural killer group protein 2, NK cell receptor A, NKG2, NKG2-1/B activating NK receptor, NKG2-A, NKG2-A/B type II integral membrane protein, NKG2-A/B-activating NK receptor, NKG2-A/NKG2-B type II integral membrane protein, NKG2AMGC59791, NKG2-B |
|---|
| Gene, Accession # | KLRC1, Gene ID: 3821, SwissProt: NP_998823 |
|---|
| Catalog # | H00003821-M01-100ug |
|---|
| Price | |
|---|
| Order / More Info | NKG2A/CD159a/KLRC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|