| 产品详情 |
| Edit |   |
| Antigenic Specificity | NKD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NKD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKD1. This antibody reacts with human. The NKD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NKD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLEQSGCYHHCVDENIE |
| Other Names | Dvl-binding protein, hNkd, hNkd1, naked cuticle homolog 1 (Drosophila), naked cuticle-1, naked-1, Naked1, NKD, protein naked cuticle homolog 1 |
| Gene, Accession # | NKD1, Gene ID: 85407, Accession: Q969G9, SwissProt: Q969G9 |
| Catalog # | NBP2-30532 |
| Price | |
| Order / More Info | NKD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|