| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKCC2/SLC12A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKCC2/SLC12A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKCC2/SLC12A1. This antibody reacts with human. The NKCC2/SLC12A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC12A1(solute carrier family 12 (sodium/potassium/chloride transporters), member 1) The peptide sequence was selected from the N terminal of SLC12A1. Peptide sequence NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFA |
|---|
| Other Names | BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter, MGC48843, NKCC2A variant A, NKCC2Na-K-2Cl cotransporter, solute carrier family 12 (sodium/potassium/chloride transporters), member 1, solute carrier family 12 member 1 |
|---|
| Gene, Accession # | SLC12A1, Gene ID: 6557, Accession: Q8IUN5, SwissProt: Q8IUN5 |
|---|
| Catalog # | NBP1-57622 |
|---|
| Price | |
|---|
| Order / More Info | NKCC2/SLC12A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22997254 |
|---|
| 产品资料 |
|
|