| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NKCC2/SLC12A1 |
|---|
| Clone | 4H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NKCC2/SLC12A1 Antibody (4H4) from Novus Biologicals is a mouse monoclonal antibody to NKCC2/SLC12A1. This antibody reacts with human. The NKCC2/SLC12A1 Antibody (4H4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SLC12A1 (NP_000329.1, 80 a.a. - 172 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA |
|---|
| Other Names | BSC1, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2, Kidney-specific Na-K-Cl symporter, MGC48843, NKCC2A variant A, NKCC2Na-K-2Cl cotransporter, solute carrier family 12 (sodium/potassium/chloride transporters), member 1, solute carrier family 12 member 1 |
|---|
| Gene, Accession # | SLC12A1, Gene ID: 6557, Accession: NP_000329, SwissProt: NP_000329 |
|---|
| Catalog # | H00006557-M03 |
|---|
| Price | |
|---|
| Order / More Info | NKCC2/SLC12A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|