| 产品详情 |
| Edit |   |
| Antigenic Specificity | SERCA1 ATPase |
| Clone | 2C7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SERCA1 ATPase Antibody (2C7) from Novus Biologicals is a mouse monoclonal antibody to SERCA1 ATPase. This antibody reacts with human. The SERCA1 ATPase Antibody (2C7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | ATP2A1 (NP_775293, 522 a.a. - 612 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ |
| Other Names | ATP2A, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform, EC 3.6.3, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, sarcoplasmic/endoplasmic reticulum calcium ATPase 1, SERCA1EC 3.6.3.8, SR Ca(2+)-ATPase 1 |
| Gene, Accession # | ATP2A1, Gene ID: 487, Accession: NP_775293, SwissProt: NP_775293 |
| Catalog # | H00000487-M03 |
| Price | |
| Order / More Info | SERCA1 ATPase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|