| Edit |   |
| Antigenic Specificity | Septin-12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Septin-12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Septin-12. This antibody reacts with human. The Septin-12 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD. |
| Other Names | FLJ25410, septin 12, septin-12 |
| Gene, Accession # | SEPT12, Gene ID: 124404, Accession: Q8IYM1, SwissProt: Q8IYM1 |
| Catalog # | NBP1-58117-20ul |
| Price | |
| Order / More Info | Septin-12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |