| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RDH11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RDH11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RDH11. This antibody reacts with human. The RDH11 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RDH11(retinol dehydrogenase 11 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the C terminal of RDH11. Peptide sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR. |
|---|
| Other Names | Androgen-regulated short-chain dehydrogenase/reductase 1, ARSDR1CGI82, EC 1.1.1.300, HCBP12, HCV core-binding protein HCBP12, MDT1, prostate short-chain dehydrogenase reductase 1, Prostate short-chain dehydrogenase/reductase 1, PSDR1FLJ32633, RALR1, Retinal reductase 1, retinol dehydrogenase 11, retinol dehydrogenase 11 (all-trans and 9-cis), retinol dehydrogenase 11 (all-trans/9-cis/11-cis), SCALD, SDR7C1, short chain dehydrogenase/reductase family 7C, member 1 |
|---|
| Gene, Accession # | RDH11, Gene ID: 51109, Accession: Q8TC12, SwissProt: Q8TC12 |
|---|
| Catalog # | NBP1-57976-20ul |
|---|
| Price | |
|---|
| Order / More Info | RDH11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|