| Edit |   |
| Antigenic Specificity | RD3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RD3. This antibody reacts with human. The RD3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RD3(retinal degeneration 3) The peptide sequence was selected from the N terminal of RD3. Peptide sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV. |
| Other Names | LCA12C1orf36chromosome 1 open reading frame 36, protein RD3, retinal degeneration 3 |
| Gene, Accession # | RD3, Gene ID: 343035, Accession: Q7Z3Z2, SwissProt: Q7Z3Z2 |
| Catalog # | NBP1-55461-20ul |
| Price | |
| Order / More Info | RD3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |