| Edit |   |
| Antigenic Specificity | RCOR2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry Free-Floating |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RCOR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RCOR2. This antibody reacts with mouse. The RCOR2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry Free-Floating. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Rcor2. Immunizing peptide sequence PPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFF. |
| Other Names | CoREST2, REST corepressor 2 |
| Gene, Accession # | RCOR2, Gene ID: 283248 |
| Catalog # | NBP1-74099-20ul |
| Price | |
| Order / More Info | RCOR2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26795843 |